Shelf life (days): 1460.0
Formulation: A solid
Formal Name: L-histidyl-L-seryl-L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-a-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-a-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-arginyl-glycinamide, trifuoroacetate salt
Amino Acids: HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2
Purity: ≥98%
Formula Markup: C151H229N41O47 / XCF3COOH
Formula Weight: 3370.7
CAS Number: 753024-08-7
Notes: A peptide agonist of GLP-1R and a derivative of GLP-1 (7-36) amide; induces cAMP accumulation in RIN T3 cells (EC50 = 15 nM); reduces blood levels of glucose in the OGTT, serum levels of Il-1β, Il-6, and Tnf-α, and fat mass in diabetic db/db mice in lyophilized L. lactis, p.o.