BAY 55-9837 (trifluoroacetate salt)

BAY 55-9837 (trifluoroacetate salt)
SKU
CAY36752-5
Packaging Unit
5 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-histidyl-L-seryl-L-a-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-a-aspartyl-L-asparaginyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-valyl-L-alanyl-L-alanyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-isoleucyl-L-lysyl-L-asparaginyl-L-lysyl-L-arginyl-L-tyrosinamide, trifluoroacetate salt

Amino Acids: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2

Purity: ≥98%

Formula Markup: C167H270N52O46 / XCF3COOH

Formula Weight: 3742.25358

Notes: BAY 55-9837 is a peptide vasoactive intestinal polypeptide receptor 2 (VPAC2) agonist.{66469} It binds to VPAC2 (Kd = 65 nM) and selectively induces cAMP production in CHO cells expressing human VPAC2 over VPAC1 or the PACAP type I (PAC1) receptor (EC50s = 0.4, 100, and >1,000 nM, respectively). BAY 55-9837 (100 nM) increases glucose-dependent insulin secretion in isolated rat and human pancreatic islets. In vivo, BAY 55-9837 enhances glucose-induced insulin secretion in fasted rats (ED50 = ~3 pmol/kg).
More Information
SKU CAY36752-5
Manufacturer Cayman Chemical
Manufacturer SKU 36752-5
Package Unit 5 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download