Lixisenatide (acetate), CAS 1997361-87-1

Lixisenatide (acetate), CAS 1997361-87-1
SKU
CAY39739-50
Packaging Unit
50 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-histidylglycyl-L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-a-glutamyl-L-a-glutamyl-L-a-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-a-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-seryl-L-lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysinamide, acetate

Amino Acids: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Purity: ≥98%

Formula Markup: C215H347N61O65S / XC2H4O2

Formula Weight: 4858.5

CAS Number: 1997361-87-1

Notes: Lixisenatide is an agonist of glucagon-like peptide 1 receptor (GLP-1R) and a derivative of exendin-4 (48-86) amide (Item No. 11096).{66567} It binds to CHO-K1 cells expressing human GLP-1R (IC50 = 1.4 nM). Lixisenatide (100 pM) inhibits Il-1β- and IFN-γ-induced apoptosis in INS-1 rat pancreatic β-cells.{66568} It lowers blood glucose levels in an oral glucose tolerance test (OGTT; ED50 = 0.021 nmol/kg) and decreases blood levels of hemoglobin A1c (HbA1c) in db/db mice.{66567} Formulations containing lixisenatide have been used adjuncts to diet and exercise to improve glycemic control in patients with type 2 diabetes mellitus.
More Information
SKU CAY39739-50
Manufacturer Cayman Chemical
Manufacturer SKU 39739-50
Package Unit 50 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download