TIP39 (human, bovine) (trifluoroacetate salt)

TIP39 (human, bovine) (trifluoroacetate salt)
SKU
CAY37452-1
Packaging Unit
1 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-a-aspartyl-L-a-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-a-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-a-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparaginyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-a-aspartyl-L-alanyl-L-proline, trifluoroacetate salt

Amino Acids: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-OH

Purity: ≥98%

Formula Markup: C202H325N61O54S / XCF3COOH

Formula Weight: 4504.18664

Notes: TIP39 is a neuropeptide and parathyroid hormone receptor type 2 (PTH2R) agonist.{51480} It induces cAMP accumulation in COS-7 cells expressing recombinant human or rat PTH2R (EC50s = 0.5 and 0.8 nM, respectively) and F-11 cells that endogenously express PTH2R (EC50 = 1.15 nM). TIP39 (1 nM) induces cell cycle arrest at the G0/G1 phase and decreases expression of the master regulator of cartilage differentiation Sox9 in CFK2 rat chondrocytes.{51481} TIP39 (100 pmol/animal) decreases immobility time in the forced swim test in mice.{51482}
More Information
SKU CAY37452-1
Manufacturer Cayman Chemical
Manufacturer SKU 37452-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download