WaTx (36-68) (scorpion) (trifluoroacetate salt)

WaTx (36-68) (scorpion) (trifluoroacetate salt)
SKU
CAY37495-5
Packaging Unit
5 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-alanyl-L-seryl-L-prolyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-lysyl-L-tyrosyl-L-cysteinyl-L-tyrosyl-L-a-glutamyl-L-glutaminyl-L-cysteinyl-L-asparaginyl-L-valyl-L-asparaginyl-L-lysyl-L-valyl-L-prolyl-L-phenylalanyl-L-a-aspartyl-L-glutaminyl-L-cysteinyl-L-tyrosyl-L-glutaminyl-L-methionyl-L-cysteinyl-L-seryl-L-prolyl-L-leucyl-L-a-glutamyl-L-arginyl-L-serine, trifluoroacetate salt

Amino Acids: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS-OH

Purity: ≥95%

Formula Markup: C164H245N45O53S5 / XCF3COOH

Formula Weight: 3855.3016

Notes: Wasabi receptor toxin (WaTx) (36-68) is a cell-penetrating peptide that corresponds to the mature toxin sequence and is an activator of transient receptor potential ankyrin 1 (TRPA1).{72198} It selectively induces currents in HEK293T cells expressing human TRPA1 (EC50 = 15 nM) over cells expressing human TRP melastatin 8 (TRPM8) or human TRP vanilloid 1 (TRPV1) at 100 nM or rat voltage-gated potassium channel 1.2 (Kv1.2), rat Kv2.1, rat Kv3.1, or rat Kv4.3 at 1,000 nM. WaTx induces nocifensive behavior in wild-type but not Trpa1-/- mice.
More Information
SKU CAY37495-5
Manufacturer Cayman Chemical
Manufacturer SKU 37495-5
Package Unit 5 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download