PrEST Antigen CLEC18B

C-type lectin domain family 18, member B
SKU
ATLAPREST89096
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: IPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQL

GeneName: CLEC18B

Ensembl Gene ID: ENSG00000140839

UniProt ID: Q6UXF7

Entrez Gene ID: 497190

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000033633: 63%, ENSRNOG00000022721: 65%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST89096
Manufacturer Atlas Antibodies
Manufacturer SKU APREST89096-100
Package Unit 100 µl
Quantity Unit STK
Application Blocking, Control
Human Gene ID 497190
Host Escherichia Coli
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download