PrEST Antigen CLEC2A

C-type lectin domain family 2, member A
SKU
ATLAPREST83841
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: DDTRNWTASKIFCSLQKAELAQIDTQEDME

GeneName: CLEC2A

Ensembl Gene ID: ENSG00000188393

UniProt ID: Q6UVW9

Entrez Gene ID: 387836

Buffer: PBS and 1M Urea, pH 7.4.

Concentration: 3.0

Interspecies Mouse/Rat: ENSRNOG00000037076: 53%, ENSMUSG00000030142: 43%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST83841
Manufacturer Atlas Antibodies
Manufacturer SKU APREST83841-100
Package Unit 100 µl
Quantity Unit STK
Application Blocking, Control
Human Gene ID 387836
Host Escherichia Coli
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download