PrEST Antigen CLEC2D

C-type lectin domain family 2, member D
SKU
ATLAPREST71636
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGA

GeneName: CLEC2D

Ensembl Gene ID: ENSG00000069493

UniProt ID: Q9UHP7

Entrez Gene ID: 29121

Buffer: PBS and 1M Urea, pH 7.4.

Concentration: 1.8

Interspecies Mouse/Rat: ENSMUSG00000000248: 47%, ENSRNOG00000061757: 47%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST71636
Manufacturer Atlas Antibodies
Manufacturer SKU APREST71636-100
Package Unit 100 µl
Quantity Unit STK
Application Blocking, Control
Human Gene ID 29121
Host Escherichia Coli
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download