PrEST Antigen CLEC5A

C-type lectin domain family 5 member A
SKU
ATLAPREST94152-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: PSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD

GeneName: CLEC5A

Ensembl Gene ID: ENSG00000258227

UniProt ID: Q9NY25

Entrez Gene ID: 23601

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000026306: 66%, ENSMUSG00000029915: 62%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST94152-100
Manufacturer Atlas Antibodies
Manufacturer SKU APREST94152-100
Package Unit 100 µl
Quantity Unit STK
Application Blocking
Human Gene ID 23601
Host Escherichia Coli
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download