PrEST Antigen ERLEC1

endoplasmic reticulum lectin 1
SKU
ATLAPREST78931
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE

GeneName: ERLEC1

Ensembl Gene ID: ENSG00000068912

UniProt ID: Q96DZ1

Entrez Gene ID: 27248

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000020311: 94%, ENSRNOG00000007283: 94%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST78931
Manufacturer Atlas Antibodies
Manufacturer SKU APREST78931-100
Package Unit 100 µl
Quantity Unit STK
Application Blocking, Control
Human Gene ID 27248
Host Escherichia Coli
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download