PrEST Antigen LMAN2L

lectin, mannose-binding 2-like

Sequence: RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLP

GeneName: LMAN2L

Ensembl Gene ID: ENSG00000114988

UniProt ID: Q9H0V9

Entrez Gene ID: 81562

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000015699: 93%, ENSMUSG00000001143: 93%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPREST86409
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APREST86409-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Application: Blocking, Control
• Human Gene ID: 81562
• Host: Escherichia Coli
• Conjugate: Unconjugated