PrEST Antigen MASP1

mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
SKU
ATLAPREST84529
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT

GeneName: MASP1

Ensembl Gene ID: ENSG00000127241

UniProt ID: P48740

Entrez Gene ID: 5648

Buffer: PBS and 1M Urea, pH 7.4.

Concentration: 3.9

Interspecies Mouse/Rat: ENSRNOG00000001827: 88%, ENSMUSG00000022887: 88%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST84529
Manufacturer Atlas Antibodies
Manufacturer SKU APREST84529-100
Package Unit 100 µl
Quantity Unit STK
Application Blocking, Control
Human Gene ID 5648
Host Escherichia Coli
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download