Recombinant Human Ficolin-3 (FCN3)

Recombinant Human Ficolin-3 (FCN3)
SKU
CSB-EP008552HUC7-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Immunology

Uniprot: O75636

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 34.8 kDa

Gene Names: FCN3

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 24-299aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

Endotoxin: Not test.

Relevance: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota.

Reference: "Signal peptide prediction based on analysis of experimentally verified cleavage sites."Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004)

Function: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota.
More Information
SKU CSB-EP008552HUC7-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP008552HUC7-100
Package Unit 100 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download