Research Areas: Others
Uniprot: P02870
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 27.3 kDa
Gene Names: N/A
Organism: Lens culinaris (Lentil) (Cicer lens)
Source: E.coli
Expression Region: 31-210aa
Protein Length: Partial
Target Protein Sequence: TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYP
Endotoxin: Not test.
Relevance: D-mannose specific lectin.
Reference: "NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction."Casset F., Hamelryck T., Loris R., Brisson J.R., Tellier C., Dao-Thi M.H., Wyns L., Poortmans F., Perez S., Imberty A.J. Biol. Chem. 270:25619-25628(1995)
English
Deutsch
