Recombinant Lens culinaris Lectin, partial

Recombinant Lens culinaris Lectin, partial
SKU
CSB-EP355890LLM-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: P02870

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 27.3 kDa

Gene Names: N/A

Organism: Lens culinaris (Lentil) (Cicer lens)

Source: E.coli

Expression Region: 31-210aa

Protein Length: Partial

Target Protein Sequence: TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYP

Endotoxin: Not test.

Relevance: D-mannose specific lectin.

Reference: "NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction."Casset F., Hamelryck T., Loris R., Brisson J.R., Tellier C., Dao-Thi M.H., Wyns L., Poortmans F., Perez S., Imberty A.J. Biol. Chem. 270:25619-25628(1995)
More Information
SKU CSB-EP355890LLM-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP355890LLM-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download