Recombinant Mouse Galectin-4 (Lgals4)

Recombinant Mouse Galectin-4 (Lgals4)
SKU
CSB-YP812998MO-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Tags & Cell Markers

Uniprot: Q8K419

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 38.4 kDa

Gene Names: Lgals4

Organism: Mus musculus (Mouse)

Source: Yeast

Expression Region: 1-326aa

Protein Length: Full Length

Target Protein Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Endotoxin: Not test.

Relevance: Galectin that binds lactose and a related range of sugars.

Reference: "Crystal structure of the N-terminal domain of mouse galectin-4."RIKEN structural genomics initiative (RSGI)Submitted (OCT-2007)

Function: Galectin that binds lactose and a related range of sugars.
More Information
SKU CSB-YP812998MO-20
Manufacturer Cusabio
Manufacturer SKU CSB-YP812998MO-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download