Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3

Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3
SKU
CSB-EP309229OBG-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: P86179

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 27 kDa

Gene Names: N/A

Organism: Oncorhynchus keta (Chum salmon) (Salmo keta)

Source: E.coli

Expression Region: 1-195aa

Protein Length: Full Length

Target Protein Sequence: AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD

Endotoxin: Not test.

Relevance: L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

Reference: "Isolation and characterization of L-rhamnose-binding lectins from chum salmon (Oncorhynchus keta) eggs."Shiina N., Tateno H., Ogawa T., Muramoto K., Saneyoshi M., Kamiya H.Fish. Sci. 68:1352-1366(2002)

Function: L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.
More Information
SKU CSB-EP309229OBG-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP309229OBG-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download