Recombinant Rat Galectin-4 (Lgals4)

Recombinant Rat Galectin-4 (Lgals4)
SKU
CSB-EP012889RA-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: P38552

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 52.3 kDa

Gene Names: Lgals4

Organism: Rattus norvegicus (Rat)

Source: E.coli

Expression Region: 1-324aa

Protein Length: Full Length

Target Protein Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI

Endotoxin: Not test.

Relevance: Galectin that binds lactose and a related range of sugars.

Reference: "Soluble lactose-binding lectin from rat intestine with two different carbohydrate-binding domains in the same peptide chain."Oda Y., Herrmann J., Gitt M., Turck C.W., Burlingame A.L., Barondes S.H., Leffler H.J. Biol. Chem. 268:5929-5939(1993)

Function: Galectin that binds lactose and a related range of sugars.
More Information
SKU CSB-EP012889RA-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP012889RA-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download