Research Areas: others
Uniprot: P81859
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal GST-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 32.1 kDa
Gene Names: N/A
Organism: Viscum album (European mistletoe)
Source: E.coli
Expression Region: 1-49aa
Protein Length: Full Length
Target Protein Sequence: IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL
Endotoxin: Not test.
Relevance: Chitin-binding lectin which is specific for N-acetylglucosamine oligomers.
Reference: "Complete structural characterization of a chitin-binding lectin from mistletoe extracts."Voelter W., Wacker R., Franz M., Maier T., Stoeva S.J. Prakt. Chem. 342:812-818(2000)
English
Deutsch
