Recombinant Viscum album Chitin-binding lectin

Recombinant Viscum album Chitin-binding lectin
SKU
CSB-EP305626VDO-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: others

Uniprot: P81859

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 32.1 kDa

Gene Names: N/A

Organism: Viscum album (European mistletoe)

Source: E.coli

Expression Region: 1-49aa

Protein Length: Full Length

Target Protein Sequence: IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL

Endotoxin: Not test.

Relevance: Chitin-binding lectin which is specific for N-acetylglucosamine oligomers.

Reference: "Complete structural characterization of a chitin-binding lectin from mistletoe extracts."Voelter W., Wacker R., Franz M., Maier T., Stoeva S.J. Prakt. Chem. 342:812-818(2000)
More Information
SKU CSB-EP305626VDO-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP305626VDO-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download