RVG Peptide (trifluoroacetate salt)

RVG Peptide (trifluoroacetate salt)
SKU
CAY41606-25
Packaging Unit
25 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-tyrosyl-L-threonyl-L-isoleucyl-L-tryptophyl-L-methionyl-L-prolyl-L-a-glutamyl-L-asparaginyl-L-prolyl-L-arginyl-L-prolylglycyl-L-threonyl-L-prolyl-L-cysteinyl-L-a-aspartyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-arginylglycyl-L-lysyl-L-arginyl-L-alanyl-L-seryl-L-asparaginyl-glycine, trifluoroacetate salt

Amino Acids: YTIWMPENPRPGTPCDIFTNSRGKRASNG-OH

Purity: ≥98%

Formula Markup: C141H217N43O43S2 / XCF3COOH

Formula Weight: 3266.6

Notes: Rabies virus glycoprotein (RVG) peptide is a nicotinic acetylcholine receptor (nAChR) antagonist (IC50 = 2.5 µM for the human receptor).{51872} Lipid nanoparticles (LNPs) conjugated to RVG peptide selectively traffic to the brain over the lungs and liver in rats.{51873} LNPs conjugated to RVG peptide and encapsulating the iron chelator and prolyl hydroxylase inhibitor deferoxamine (DFO; Item No. 14595) reduce iron levels in the striatum and substantia nigra, as well as decrease levels of reactive oxygen species (ROS) and malondialdehyde (MDA) and increase levels of superoxide dismutase (SOD) in the substantia nigra in a mouse model of MPTP-induced Parkinson's disease. RVG-containing and DFO-encapsulating LNPs also increase the latency to fall in the rotarod test in the same model.
More Information
SKU CAY41606-25
Manufacturer Cayman Chemical
Manufacturer SKU 41606-25
Package Unit 25 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download