Recombinant Arabidopsis thaliana Gibberellin-regulated protein 14 (GASA14)

Recombinant Arabidopsis thaliana Gibberellin-regulated protein 14 (GASA14)
SKU
CSB-EP862779DOAC7-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: Q9LFR3

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 33.7 kDa

Gene Names: GASA14

Organism: Arabidopsis thaliana (Mouse-ear cress)

Source: E.coli

Expression Region: 22-275aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: ASNEESNALVSLPTPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPPVRTRIDCVPLCGTRCGQHSRKNVCMRACVTCCYRCKCVPPGTYGNKEKCGSCYANMKTRGGKSKCP

Endotoxin: Not test.

Relevance: Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.
More Information
SKU CSB-EP862779DOAC7-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP862779DOAC7-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download