Research Areas: Cell Biology
Uniprot: Q9TT99
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 14.3 kDa
Gene Names: ATOX1
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Source: E.coli
Expression Region: 1-68aa
Protein Length: Full Length
Target Protein Sequence: MPKHEFSVDMTCEGCSNAVSRVLNKLGGVEFDIDLPNKKVCINSEHSVDILLETLEKTGKAVSYLGPK
Endotoxin: Not test.
Biological_Activity: Not Test
Relevance: Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
English
Deutsch
