Recombinant Human Collagen alpha-1 (XXI) chain (COL21A1), Partial

Research Areas: Signal Transduction

Uniprot: Q96P44

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 35.5 kDa

Gene Names: COL21A1

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 129-208aa

Protein Length: Partial

Target Protein Sequence: AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK

Endotoxin: Not test.

• SKU: CSB-EP836273HU-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP836273HU-100
• Package Unit: 100 µg
• Quantity Unit: STK