Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)
SKU
CSB-EP875707HU(A4)-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Signal Transduction

Uniprot: Q9HAV7

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 48.2 kDa

Gene Names: GRPEL1

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 28-217aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Endotoxin: Not test.

Relevance: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.
More Information
SKU CSB-EP875707HU(A4)-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP875707HU(A4)-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×