Recombinant Human Heme-binding protein 1 (HEBP1)

Recombinant Human Heme-binding protein 1 (HEBP1)
SKU
CSB-EP868305HUE0-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Cardiovascular

Uniprot: Q9NRV9

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 48.6 kDa

Gene Names: HEBP1

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-189aa

Protein Length: Full Length

Target Protein Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT

Endotoxin: Not test.

Relevance: May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities.
More Information
SKU CSB-EP868305HUE0-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP868305HUE0-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download