Research Areas: Cancer
Uniprot: Q9UBP8
Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Form: Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 15.9 kDa
Gene Names: KAAG1
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 1-84aa
Protein Length: Full Length
Target Protein Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 2.040-2.284 ng/mL.
Reference: "A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription."Van den Eynde B.J., Gaugler B., Probst-Kepper M., Michaux L., Devuyst O., Lorge F., Weynants P., Boon T.. Exp. Med. 190:1793-1800 (1999)
English
Deutsch
