Recombinant Human Kidney-associated antigen 1(KAAG1) (Active)

Recombinant Human Kidney-associated antigen 1(KAAG1) (Active)
SKU
CSB-EP871385HU-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Cancer

Uniprot: Q9UBP8

Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Form: Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 15.9 kDa

Gene Names: KAAG1

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-84aa

Protein Length: Full Length

Target Protein Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 2.040-2.284 ng/mL.

Reference: "A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription."Van den Eynde B.J., Gaugler B., Probst-Kepper M., Michaux L., Devuyst O., Lorge F., Weynants P., Boon T.. Exp. Med. 190:1793-1800 (1999)
More Information
SKU CSB-EP871385HU-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP871385HU-100
Package Unit 100 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download