Recombinant Human P2X purinoceptor 7 (P2RX7), partial

Recombinant Human P2X purinoceptor 7 (P2RX7), partial
SKU
CSB-EP859103HU-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Neuroscience

Uniprot: Q99572

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 43.1 kDa

Gene Names: P2RX7

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 47-334aa

Protein Length: Partial

Target Protein Sequence: SDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLV

Endotoxin: Not test.

Biological_Activity: Not Test

Relevance: Receptor for ATP that acts as a ligand-gated ion channel. Responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Could function in both fast synaptic transmission and the ATP-mediated lysis of antigen-presenting cells. In the absence of its natural ligand, ATP, functions as a scavenger receptor in the recognition and engulfment of apoptotic cells.
More Information
SKU CSB-EP859103HU-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP859103HU-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download