Recombinant Human Peptide deformylase, mitochondrial (PDF)

Recombinant Human Peptide deformylase, mitochondrial (PDF)
SKU
CSB-EP872538HU-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: Q9HBH1

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 30.0 kDa

Gene Names: PDF

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 40-243aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: EGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND

Endotoxin: Not test.

Biological_Activity: Not Test

Relevance: Removes the formyl group from the N-terminal Met of newly synthesized proteins.
More Information
SKU CSB-EP872538HU-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP872538HU-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download