Recombinant Human Protein GAPT (GAPT), partial

Recombinant Human Protein GAPT (GAPT), partial
SKU
CSB-EP839783HU1A2-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Metabolism

Uniprot: Q8N292

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 27.7 kDa

Gene Names: GAPT

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 32-157aa

Protein Length: partial

Target Protein Sequence: HWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY

Endotoxin: Not test.

Relevance: Negatively regulates B-cell proliferation following stimulation through the B-cell receptor. May play an important role in maintenance of marginal zone (MZ) B-cells.
More Information
SKU CSB-EP839783HU1A2-20
Manufacturer Cusabio
Manufacturer SKU CSB-EP839783HU1A2-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download