Recombinant Human Protein phosphatase PTC7 homolog (PPTC7)

Recombinant Human Protein phosphatase PTC7 homolog (PPTC7)
SKU
CSB-EP836783HU-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Cell Biology

Uniprot: Q8NI37

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 32.6 kDa

Gene Names: PPTC7

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 69-304aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: RSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD

Endotoxin: Not test.

Relevance: Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q. Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation.
More Information
SKU CSB-EP836783HU-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP836783HU-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download