Recombinant Human SPARC-related modular calcium-binding protein 1(SMOC1), partial

Recombinant Human SPARC-related modular calcium-binding protein 1(SMOC1), partial
SKU
CSB-EP875673HU1F0-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Developmental Biology

Uniprot: Q9H4F8

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal GST-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 43.2 kDa

Gene Names: SMOC1

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 277-382aa

Protein Length: Partial

Target Protein Sequence: GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR

Endotoxin: Not test.

Relevance: Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation.
More Information
SKU CSB-EP875673HU1F0-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP875673HU1F0-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download