Research Areas: Others
Uniprot: Q8HXQ1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-SUMO-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 28.8 kDa
Gene Names: SOD1
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: E.coli
Expression Region: 2-154aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: AMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQ
Endotoxin: Not test.
Relevance: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
English
Deutsch
