Research Areas: Immunology
Uniprot: Q8VEJ3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-SUMO-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 35.4 kDa
Gene Names: Dkk4
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 19-221aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: LVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRSQVTSNRQHSRLRVCQRI
Endotoxin: Not test.
Relevance: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
English
Deutsch
