Research Areas: Cardiovascular
Uniprot: Q9Z0J7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-SUMO-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 25.5 kDa
Gene Names: Gdf15
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 189-303aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Endotoxin: Not test.
Relevance: Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling.
Reference: "Long-acting MIC-1/GDF15 molecules to treat obesity: Evidence from mice to monkeys."Xiong Y., Walker K., Min X., Hale C., Tran T., Komorowski R., Yang J., Davda J., Nuanmanee N., Kemp D., Wang X., Liu H., Miller S., Lee K.J., Wang Z., Veniant M.M.Sci. Transl. Med. 9:0-0(2017)
English
Deutsch
