Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial

Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial
SKU
CSB-EP875357MOA2-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Immunology

Uniprot: Q9ERS7

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 49.0 kDa

Gene Names: Il1rl2

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 22-338aa

Protein Length: Partial

Target Protein Sequence: DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Endotoxin: Not test.

Relevance: Receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.
More Information
SKU CSB-EP875357MOA2-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP875357MOA2-100
Package Unit 100 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download