Recombinant Mouse Interleukin-36 gamma (Il36g)

Recombinant Mouse Interleukin-36 gamma (Il36g)
SKU
CSB-EP840290MO-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Immunology

Uniprot: Q8R460

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 10xHis-tagged

Purity: Greater than 95% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 20.1 kDa

Gene Names: Il36g

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 1-164aa

Protein Length: Full Length

Target Protein Sequence: MFSKHPFSTHISGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Endotoxin: Not test.

Relevance: Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T-cells and splenocytes.
More Information
SKU CSB-EP840290MO-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP840290MO-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download