Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)

Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)
SKU
CSB-EP832069FSG-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: P9WPE5

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 37.5 kDa

Gene Names: groES

Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Source: E.coli

Expression Region: 2-100aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: AKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

Endotoxin: Not test.

Relevance: Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel.
More Information
SKU CSB-EP832069FSG-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP832069FSG-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download