Recombinant Neurospora crassa Probable vesicular-fusion protein sec17 homolog

Recombinant Neurospora crassa Probable vesicular-fusion protein sec17 homolog
SKU
CSB-EP868419NHA-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: Q9P6A5

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 39.7 kDa

Gene Names: N/A

Organism: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Source: E.coli

Expression Region: 1-292aa

Protein Length: Full Length

Target Protein Sequence: MAVDPRVLQQEAEKTLASASKGWGLFGNKEDKYQNAADQYIQAANAFRLQKSNTEAGKCFEEAAKIFTEKLKEPNDAANAMLDAFKVYRKDAPDNAVRCVEVAIKQYTMAGNFRRAASHKENQAEVYENELQNKPEAIKAYTTAAEWYENDGAVALANKLWLKVADLSALAGDFFAAIEKFEKVAEASLGNNLMRYSVKEYFLKAGLCSLATKDMVTAQRNITKYAEKDPSFTGQREYQLLVDLLEAASNNNLEMFQDKLAAYDKMSRLDDWKAAVLLQIKNNFEEADNEFS

Endotoxin: Not test.

Relevance: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
More Information
SKU CSB-EP868419NHA-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP868419NHA-100
Package Unit 100 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download