Research Areas: Others
Uniprot: Q9P6A5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 39.7 kDa
Gene Names: N/A
Organism: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Source: E.coli
Expression Region: 1-292aa
Protein Length: Full Length
Target Protein Sequence: MAVDPRVLQQEAEKTLASASKGWGLFGNKEDKYQNAADQYIQAANAFRLQKSNTEAGKCFEEAAKIFTEKLKEPNDAANAMLDAFKVYRKDAPDNAVRCVEVAIKQYTMAGNFRRAASHKENQAEVYENELQNKPEAIKAYTTAAEWYENDGAVALANKLWLKVADLSALAGDFFAAIEKFEKVAEASLGNNLMRYSVKEYFLKAGLCSLATKDMVTAQRNITKYAEKDPSFTGQREYQLLVDLLEAASNNNLEMFQDKLAAYDKMSRLDDWKAAVLLQIKNNFEEADNEFS
Endotoxin: Not test.
Relevance: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
English
Deutsch
