Research Areas: Cancer
Uniprot: Q9TSJ4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 25.3 kDa
Gene Names: IL10
Organism: Oryctolagus cuniculus (Rabbit)
Source: E.coli
Expression Region: 19-178aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: SRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQLNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLRLRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS
Endotoxin: Not test.
Relevance: Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.
English
Deutsch
