Rimklb Antibody - N-terminal region : HRP

Rimklb Antibody - N-terminal region : HRP
SKU
AVIARP57439_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rimklb

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FRAVVMDEMVLTVEQGNLGLRISGELISAYPQVVVVRVPTPWVQSDSDIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Beta-citryl-glutamate synthase B

Protein Size: 387

Purification: Affinity Purified
More Information
SKU AVIARP57439_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57439_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 108653
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×