RLN1 Antibody - middle region : HRP

RLN1 Antibody - middle region : HRP
SKU
AVIARP56721_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In the human there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3. RLN1 and RLN2 share high sequence homology. This encoded protein is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds; however, their exact cleavage sites have not been described. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. This gene has multiple polyadenylation sites. There are multiple alternatively spliced transcript variants described for this gene but their full length nature is not known yet.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RLN1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prorelaxin H1

Protein Size: 185

Purification: Affinity Purified
More Information
SKU AVIARP56721_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56721_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6013
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×