Rpsa Antibody - N-terminal region : FITC

Rpsa Antibody - N-terminal region : FITC
SKU
AVIARP54682_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein SA

Protein Size: 295

Purification: Affinity Purified
More Information
SKU AVIARP54682_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54682_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 16785
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×