RRAD Antibody - middle region : FITC

RRAD Antibody - middle region : FITC
SKU
AVIARP56567_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAD

Key Reference: Chang,L., (2007) Circulation 116 (25), 2976-2983

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein RAD

Protein Size: 308

Purification: Affinity Purified
More Information
SKU AVIARP56567_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56567_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6236
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×