SAMHD1 Antibody - middle region : FITC

SAMHD1 Antibody - middle region : FITC
SKU
AVIARP55262_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SAMHD1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SAM domain and HD domain-containing protein 1

Protein Size: 626

Purification: Affinity Purified
More Information
SKU AVIARP55262_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55262_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25939
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×