Saxiphilin Recombinant Protein (Rana catesbeiana)

Description of Target: Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Key Reference: Purification and partial sequencing of saxiphilin, a saxitoxin-binding protein from the bullfrog, reveals homology to transferrin.Li Y., Moczydlowski E.J. Biol. Chem. 266:15481-15487(1991).

Molecular Weight: 43.7 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Saxiphilin.

Protein Sequence: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC.

Protein Size: 484-844 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: Mammalian cell.

Tag: N-terminal 6xHis-tagged

• SKU: AVIOPCA05418-500
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: OPCA05418-500
• Green Labware: No
• Package Unit: 500µg
• Quantity Unit: STK
• Reactivity: Various species