SCCPDH Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SCCPDH

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Saccharopine dehydrogenase-like oxidoreductase

Protein Size: 429

Purification: Affinity Purified

• SKU: AVIARP53711_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53711_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51097
• Host: Rabbit
• Conjugate: Conjugated, Biotin