SCCPDH Antibody - C-terminal region : FITC

SCCPDH Antibody - C-terminal region : FITC
SKU
AVIARP53711_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SCCPDH

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Saccharopine dehydrogenase-like oxidoreductase

Protein Size: 429

Purification: Affinity Purified
More Information
SKU AVIARP53711_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53711_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51097
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×